PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001516G0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB_related
Protein Properties Length: 1605aa    MW: 173415 Da    PI: 6.5912
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001516G0020genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.92.7e-09746788347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E e + +  +++G++ +++I++ ++ ++t  +c+++++k+
  PH01001516G0020 746 PWTQDEKEVFMEMLARFGKD-FSKISSFLQ-HKTTADCVEFYYKH 788
                      8*****************99.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.62E-14730791IPR009057Homeodomain-like
PROSITE profilePS5129315.641742793IPR017884SANT domain
SMARTSM007177.7E-9743791IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-7745790IPR009057Homeodomain-like
PfamPF002493.6E-7745788IPR001005SANT/Myb domain
PROSITE profilePS5129311.3989531004IPR017884SANT domain
SMARTSM007172.1E-59541002IPR001005SANT/Myb domain
SuperFamilySSF466892.5E-89571005IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.2E-4957999IPR009057Homeodomain-like
CDDcd001672.56E-4958996No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1605 aa     Download sequence    Send to blast
MPMRAAGALL LLPGVPLRVR ANHGICHRLI LAVDRGAGRT LRYKSSDLMR PPPPLPWQAS  60
PTPLIPPNRS VISEGYYRQS GAAYERSYPD EPLGYTPSRS DRYWLDDDGG GYKGFGRSYG  120
GDFPRSHQDH PPPPLGRSPL RSVAVPICYD PPGDRADRGD RDHHPRVTPW RPLRRRESRS  180
DSADAAGAGP VSVGQTTAAA TASEKEVLAQ SLAAATPQMA EDDAPRKKAR LGWGQGLAKY  240
EKQKVRGSVE PAEADAHGSP SDAEHKAGVP APASVLCASP VTCPSPAPPC SSPVPEDKSC  300
DLTANTVTES NKDVPGAEVQ ACDDEVPIKL DQLDGDPIGS LANVLAELLQ HEDSCSGDSK  360
RLTSTSKLLL LKESITKELE KTELEIDLLE GELKTVNTEA GNRTPKGSPT VVTCAQNPSP  420
SNGTSKVPVS TNETTSPVKE QGELTPSPKI TVEQDVDVNG AELLEVETAP IHNVKTVSSE  480
ESVACPGVAD SKISAAADVV PFNPSEGFGS QIKDDSERQE ANSCHDNVNS MKANGSDDLS  540
MRPCSYHDDN YNLIPSIIAA NNDIAKEASE LVFKHLSADR PYLDLLASSH LSSQRKNDLI  600
IKEKLAIHKN RLRIKEQILT FKFKVLRHLW KEDVRLLSVR KQRSKSNKRT DQSNRASQSG  660
SQRQRSCNRS RLAMPAGNLS TFPITEISDV ANKLFSEFQV KRCRNYLKMP ALIIDEKEKA  720
GAKFISKNAL IEDPVSVEKE RAMINPWTQD EKEVFMEMLA RFGKDFSKIS SFLQHKTTAD  780
CVEFYYKHHK SDSFREVKKV LDLRQQHQPT SNYLGTKSGK KWNPEANAAS LDMLGVASVV  840
AAHGLDYANR VEKISSKSII RTAYGSDIPF VTKGSTVKDS VGNVPLHERE SVAADVLAGI  900
CGALSPEGMG SCITSSADPG QKISITRMDH LLTPEVDKSF GEEGTLSDQE CEVDLVDWND  960
DEKSIFIEAM NNYGRDFARI SSCVKSKSYK QCKVFFSKAR KSLGLDLIHQ GTVDIGLPTS  1020
DTNGRRSDTD EACAAEMDSA ICSTQPCSKM EMDVCPAADG AIQGHPFSSI TSKQPEAGGS  1080
NGPDVVDVKV EEGEIKADKN CNIFVDHKRL SEATHQASCA PIDINCPEST ENTQNTEDVN  1140
QVNMHGNGAM ASSTERAAAA HMEIRSSLHS VEVIQSSKAS EGICTEVSRV EGSSHHAPEC  1200
ALMNSTPSIC LPAEGGSKEN VLHFSNMAGV SSISPAFTSS CEHTMPADVL PSKPKPQVTP  1260
LTPKDLMPVQ FSSVLPDPTS IRFEGIASIT TPNFEDHGKK VGNASGTKDT NKFPTYKDQS  1320
GNQLDGLFRN NDGYMQQRRN HHLATEVRVF SESTASGTVG ISQSDQFTLA KFQNGRSAGS  1380
SLSNATAGIL WTGNGADVQE GLLRPCSHKA SAESDEQLKR PGDVKLFGQI LSHQSSLQSS  1440
GLSSNGSKSK PLSPKIDRSA ARLLNGSRDR LVYSSRPAIT AHLGLEERAV KSTVQPEPML  1500
MVAKCQRSLA GVPFYSAKNG TLGVCTEYQQ PLMQQFPSDP NLQKRNGMEL ISGFQQSSKG  1560
SRLGGTGILV SGVSDPVAAF EVQYGPGSKI LSNDVDPWKD IGSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C2e-15704795494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D2e-15704795494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231802.10.0PREDICTED: uncharacterized protein LOC100825285
TrEMBLA0A0Q3KAE00.0A0A0Q3KAE0_BRADI; Uncharacterized protein
STRINGBRADI2G38160.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.12e-78MYB family protein